PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g074120.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 700aa    MW: 77648.4 Da    PI: 7.3771
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g074120.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-094244611954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Sopim06g074120.0.1 424 FEHflHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVR 461
                         554459******************************88 PP

2BELL120.19.6e-39288359172
                BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         +rqelq+kkakLl +leeV++rY+qy++q+q+++ssFe+vag+gsak+Yt+lAl+aiS++FrcLkdai+eq+
  Sopim06g074120.0.1 288 QRQELQMKKAKLLAMLEEVEQRYRQYHHQMQIIVSSFEQVAGVGSAKSYTQLALHAISKQFRCLKDAISEQV 359
                         69********************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.6E-59211357IPR006563POX domain
PfamPF075269.3E-49213356IPR006563POX domain
PROSITE profilePS5007112.05402465IPR001356Homeobox domain
SMARTSM003894.2E-10405469IPR001356Homeobox domain
CDDcd000866.10E-12405466No hitNo description
SuperFamilySSF466895.13E-17406471IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-29408471IPR009057Homeodomain-like
PfamPF059202.7E-18422461IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
MYYQGTSDNN IQADHHQQQH NNLGNSNNNI QTLYLMNPNS YMQGYTTTDT QQHLQQQQNQ  60
HQLLFLNSAP AGGNALSHAN IQHAPLQQQH FVGVPLPAVS LHDQINHHGL LQRMWNNQDQ  120
SQQVIVPSST VVSATSCGGT TTDLASQLAF QRPIVVSPTP QHRQQQQQQG GLSLSLSPQQ  180
QQQISFNNNI SSSSPRTNNV TIRGTMDGCS SNMILGSKYL KAAQELLDEV VNIVGKSNKG  240
DDQKKDNSMN KELIPLVSDV NTNSSGGGGG ESSSRQKNEV AVELTTAQRQ ELQMKKAKLL  300
AMLEEVEQRY RQYHHQMQII VSSFEQVAGV GSAKSYTQLA LHAISKQFRC LKDAISEQVK  360
ATSKSLGEDE GLGGKIEGSR LKFVDHHLRQ QRALQQLGMM QPNAWRPQRG LPERAVSVLR  420
AWLFEHFLHP YPKDSDKIML AKQTGLTRSQ VSNWFINARV RLWKPMVEEM YLEEVKNQEQ  480
NSSNTSGDNK NKETNISAPN EEKQPIITSS LLQDGTTQAE ISTSTISTSP TAGASLHHAH  540
NFSFLGSFNM ENTTTTVDHI ENNAKKPRNH DMHKFSPSSI LSSVEMEAKA RESTNKGFTN  600
PLMAAYAMGD FGRFDPHDQQ MTANFHGNNG VSLTLGLPPS ENLAMPVSQQ NYLSNELGSR  660
PEIGSHYNRM GYENIDFQSG NKRFPTQLLP DFVTGNLGT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16411469563Homeobox protein Meis2
3k2a_B4e-16411469563Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0134590.0BT013459.1 Lycopersicon esculentum clone 132117F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001303282.10.0bell-like homeodomain protein 2
RefseqNP_001234599.10.0bell-like homeodomain protein 2
TrEMBLQ7Y0Z70.0Q7Y0Z7_SOLLC; Bell-like homeodomain protein 2
STRINGSolyc06g074120.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.37e-96BEL1-like homeodomain 1